Skip to main content

Alfalfa Sprouts E. coli and Salmonella Lawsuit

Alfalfa Sprouts E. coli and Salmonella Lawyer

If raw alfalfa sprouts sent you to the doctor this summer, you're not imagining a connection. CDC and FDA are investigating 55 illnesses across 15 states linked to alfalfa sprouts and identify Everything Sprouts products as one source. Investigators are still looking for other sources and a possible common seed supplier. This outbreak carries two germs, E. coli and Salmonella.

$850M+
Recovered
6,000+
Cases Won
55+
Years Experience
No Fees
Unless You Win
55
Illnesses
4
Hospitalized
15
States
Active

Source: Alfalfa sprouts, including recalled Calco and Everything Sprouts products

Learn more about E. coli cases

Free Case Evaluation

Were You Affected by the Alfalfa Sprouts Outbreak?

Answer these quick questions to help our legal team understand the medical and exposure evidence.

Did you consume recalled Calco or Everything Sprouts alfalfa sprouts, or sprouts served at a restaurant in Minnesota or Wisconsin during the outbreak period?

Restaurant meals count. FDA traced these sprouts to restaurants in Minnesota and Wisconsin, so there may be no package to check. A receipt, a card statement, or the name of the restaurant is enough to start.

Were you diagnosed with E. coli or Salmonella by a doctor or lab test?

A positive stool culture or lab confirmation strengthens your case significantly.

Did you require medical treatment or hospitalization?

Medical records documenting your illness are crucial evidence.

Have you been contacted by a state or local health department about this illness?

If not, you may still have a valid claim. Choose the closest answer.

Prefer to speak with someone?

1-888-335-4901

Active & Accepting Cases

On August 22, 2026, Everything Sprouts, LLC of Minneapolis recalled Calco and Everything Sprouts alfalfa sprouts in 5 oz containers, lots 222, 223, 225, 226, and 230, plus the Crunchy Protein Sprout Mix and Zesty Garlic Mix cups made with them. It reached stores and restaurants in Minnesota and Wisconsin.

Suspected Source

Alfalfa sprouts. Investigators identified Everything Sprouts products as one source and are evaluating others.

Recall

August 22, 2026

Amount

5 lots, 3 products

Official Investigation
CDC
FDA
View official sources
Reported August 21, 2026 · Last updated August 26, 2026 · Reviewed by Ron Simon

About This Outbreak

Alfalfa Sprouts E. coli and Salmonella Lawyer

Geographic Impact

15 States Affected

FLIAINKSMIMNNCNDNHNYPASCSDWAWI
55

Confirmed Illnesses

4

Hospitalizations

Outbreak Timeline

Key Events

May 27, 2026

Everything Sprouts begins distributing the alfalfa sprouts later named in the recall, shipping to wholesale distributors, grocery stores, and restaurants in Minnesota and Wisconsin

May 31, 2026

The first person in the outbreak gets sick

Aug 8, 2026

The most recent illness in the outbreak begins, closing a stretch of more than two months of cases

Aug 19, 2026

FDA opens an inspection and begins collecting samples at Everything Sprouts in Minneapolis after traceback from Minnesota and Wisconsin restaurants points there

Aug 20, 2026

Minnesota and Wisconsin health officials announce the outbreak publicly and tell people not to eat Calco or Everything Sprouts alfalfa sprouts. Minnesota reports 23 state illnesses between July 8 and August 8 with 2 hospitalized, and Wisconsin reports 17 illnesses with 1 hospitalized

Aug 21, 2026

CDC and FDA post the outbreak, reporting 55 people infected across 15 states with three E. coli strains and Salmonella Agona, and FDA recommends that Everything Sprouts recall the product

Aug 22, 2026

Everything Sprouts, LLC recalls Calco and Everything Sprouts alfalfa sprouts in lots 222, 223, 225, 226, and 230, along with the Crunchy Protein Sprout Mix and Zesty Garlic Mix cups made with the same sprouts

Aug 24, 2026

CDC and FDA update the advisory with the recall and repeat that people should not eat, sell, or serve the sprouts

Recalled Products

These products have been recalled in connection with this outbreak.

Calco and Everything Sprouts Alfalfa Sprouts, 5 oz container

Sold at: Grocery stores including Cub, Kowalski's, and Jerry's, Wholesale distributors, Restaurants

Lot #: 222, 223, 225 +2 more
Size: 5 oz
Best By: Distributed May 27 to August 21, 2026
Distributed in: MN, WI

Everything Sprouts Crunchy Protein Sprout Mix, 5 oz cup, made with the recalled alfalfa sprouts

Sold at: Grocery stores, Wholesale distributors

Lot #: 222, 223, 226 +1 more
Size: 5 oz
Distributed in: MN, WI

Everything Sprouts Zesty Garlic Mix, 5 oz cup, made with the recalled alfalfa sprouts

Sold at: Grocery stores, Wholesale distributors

Lot #: 222, 223, 225 +2 more
Size: 5 oz
Distributed in: MN, WI

Important Safety Notice

If you have any of these products, do not consume them. Check your refrigerator and pantry, and dispose of or return affected items immediately.

Symptoms to Watch

E. coli or Salmonella Symptoms

Severe Stomach Cramps and Bloody Diarrhea

The usual E. coli picture is severe stomach cramps and diarrhea that often turns bloody, along with vomiting, starting a few days to about nine days after exposure

Diarrhea, Fever, and Cramps

Salmonella usually brings diarrhea, fever, and abdominal cramps 12 to 72 hours after a contaminated meal, and it typically lasts four to seven days

Kidney Failure (HUS)

Some people with Shiga toxin-producing E. coli develop hemolytic uremic syndrome, a form of kidney failure that needs hospital care and is most common in children under 5, older adults, and people with weakened immune systems

Lasting Damage After the Infection Clears

FDA notes that severe E. coli infection can lead to high blood pressure, chronic kidney disease, and neurologic problems that outlast the original illness

Get medical care now if you have bloody diarrhea or severe stomach cramps, and watch closely for signs of hemolytic uremic syndrome (HUS) such as reduced urination, pale skin, or unusual bruising. HUS is a life-threatening kidney complication that can appear about a week after diarrhea starts, even as it improves, and is most dangerous for young children.

Next Steps

What To Do Now

1

Check your refrigerator for Calco or Everything Sprouts alfalfa sprouts in 5 oz containers with lot 222, 223, 225, 226, or 230, and for Crunchy Protein Sprout Mix or Zesty Garlic Mix cups. Photograph the package, lot code, and receipt, then throw the sprouts out or take them back to the store

2

Wash and sanitize the shelves, drawers, and containers the sprouts touched, since raw produce can leave bacteria behind on surfaces

3

Think back to sandwiches, salads, and bowls you ate out in Minnesota or Wisconsin since late May, because FDA traced these sprouts to restaurants and sprouts are usually a garnish nobody orders on purpose

4

If your diarrhea is ongoing or recent, ask your doctor whether a stool test is still appropriate. Tell the doctor you may have eaten alfalfa sprouts and that this outbreak includes both E. coli and Salmonella, because the right testing depends on your symptoms and when they began

5

Report your illness to your state or local health department so public health investigators can determine whether it may be connected to the outbreak

6

Keep the photographs, receipt, card statement, or just the name of the restaurant. Do not keep recalled sprouts or contaminated packaging unless a health department or lawyer gives you specific safe-handling instructions. Contact Ron Simon & Associates for a free case evaluation at 1-888-335-4901

Common Questions

Alfalfa Sprouts E. coli and Salmonella Lawyer FAQ

Get answers to frequently asked questions about the Alfalfa Sprouts E. coli and Salmonella Lawyer and your legal rights.

Still Have Questions?

Our attorneys are ready to help.

Call 1-888-335-4901
If a doctor diagnosed you with E. coli or Salmonella after you ate alfalfa sprouts, you may have a claim. An alfalfa sprouts lawsuit generally runs against the grower and distributor, and in a restaurant case it can reach the restaurant that served the sprouts as well. Our E. coli lawyers are reviewing cases from this outbreak. Ron Simon & Associates handles food poisoning lawsuits nationwide and can tell you quickly during a free consultation whether you have a case.

Sources & Citations

Information on this page is compiled from the following authoritative sources:

Government Sources

News Sources

This content is provided for informational purposes only and does not constitute legal advice. Information is current as of the date accessed. For the most up-to-date outbreak information, please consult official CDC and FDA websites.

Free Case Evaluation

Affected by This Outbreak?We Can Help.

Don't wait to get the legal help you deserve. Our experienced E. coli or Salmonella attorneys are standing by to evaluate your case at no cost.

No Fee Unless We Win
Rapid Response